A15301
PKNOX1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15301
- Zusätzliche Namen:
- PKNOX1|pkonx1c|PREP1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LDSSCSETPKTKKKTAQNRPVQRFWPDSIASGVAQPPPSELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALAPAHISGLVLENSDSLQ
- Uniprot:
- P55347
- Synonyme:
- homeobox protein PKNOX1;homeobox protein PREP-1;human homeobox-containing protein;Pbx regulating protein-1;PBX/knotted homeobox 1;pkonx1c;PREP1
- Weitere Details:
- Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in angiogenesis and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within camera-type eye development; hemopoiesis; and positive regulation of transcription by RNA polymerase II. Predicted to be located in cytoplasm and nucleus. Predicted to be part of chromatin.
- Versandbedingungen:
- Blue Ice