MYF6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15291
Zusätzliche Namen:: bHLHc4|CNM3|MRF4|myf-6|MYF6
Anwendung:: ELISA, WB
Molekulargewicht:: 27kDa/37kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL
Uniprot:: P23409
Synonyme:: bHLHc4;class C basic helix-loop-helix protein 4;CNM3;MRF4;muscle-specific regulatory factor 4;myf-6;myogenic factor 6;myogenic factor 6 (herculin)
Weitere Details:: The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM).