CTNNA2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15269
Zusätzliche Namen:: CAP-R|CAPR|CDCBM9|CT114|CTNNA2|CTNR
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 102kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILD
Uniprot:: P26232
Synonyme:: Alpha N-catenin;alpha-catenin-related protein;alpha-N-catenin;cadherin-associated protein, related;cancer/testis antigen 114;CAP-R;CAPR;catenin (cadherin-associated protein), alpha 2;catenin alpha-2;CDCBM9;CT114;CTNR
Weitere Details:: Enables actin filament binding activity. Involved in negative regulation of Arp2/3 complex-mediated actin nucleation; regulation of neuron migration; and regulation of neuron projection development. Located in cytoplasm. Implicated in complex cortical dysplasia with other brain malformations.