CENPE Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15263
Zusätzliche Namen:: CENP-E|CENPE|KIF10|MCPH13|PPP1R61
Anwendung:: ELISA, WB
Molekulargewicht:: 270kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHLSNEVKTWKERTLKREAHKQVTCENSPKSPKVTGTASKKKQITPSQCKERNLQDPVPKESPKSCFFDSRSKSLPSPHPVRYFDNSSLGLCPEVQNAGAESVDSQPGPWHASSGKDVPECKTQ
Uniprot:: Q02224
Synonyme:: CENP-E;Centromere autoantigen E (312kD);Centromere protein E;centromere protein E, 312kDa;centromere-associated protein E;KIF10;kinesin family member 10;kinesin-7;kinesin-related protein CENPE;MCPH13;PPP1R61;protein phosphatase 1, regulatory subunit 61
Weitere Details:: Centrosome-associated protein E (CENPE) is a kinesin-like motor protein that accumulates in the G2 phase of the cell cycle. Unlike other centrosome-associated proteins, it is not present during interphase and first appears at the centromere region of chromosomes during prometaphase. This protein is required for stable spindle microtubule capture at kinetochores which is a necessary step in chromosome alignment during prometaphase. This protein also couples chromosome position to microtubule depolymerizing activity. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms.

Versandbedingungen:: Blue Ice