ATP1A4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15256
Zusätzliche Namen:: ATP1A1|ATP1A4|ATP1AL2
Anwendung:: ELISA, WB
Molekulargewicht:: 100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELSTKYSVDLTKGHSHQRAKEILTRGGPNTVTP
Uniprot:: Q13733
Synonyme:: ATP1A1;ATP1AL2;ATPase, Na+/K+ transporting, alpha 4 polypeptide;ATPase, Na+/K+ transporting, alpha polypeptide-like 2;Na,K-ATPase subunit alpha-C;Na(+)/K(+) ATPase alpha-4 subunit;Na+/K+ ATPase 4;Na+/K+ ATPase, alpha-D polypeptide;sodium pump 4;sodium pump subunit alpha-4;sodium-potassium ATPase catalytic subunit alpha-4;sodium/potassium-transporting ATPase alpha-4 chain;sodium/potassium-transporting ATPase subunit alpha-4
Weitere Details:: The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 4 subunit. Alternatively spliced transcript variants encoding different isoforms have been identified.

Versandbedingungen:: Blue Ice