A15245
EPRS Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15245
- Zusätzliche Namen:
- EARS|EPRS|GLUPRORS|HLD15|PARS|PIG32|QARS|QPRS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 190kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EAKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSS
- Uniprot:
- P07814
- Synonyme:
- bifunctional aminoacyl-tRNA synthetase;bifunctional glutamate/proline--tRNA ligase;cell proliferation-inducing gene 32 protein;EARS;EPRS;GLUPRORS;glutamate tRNA ligase;glutamatyl-prolyl-tRNA synthetase;glutaminyl-tRNA synthetase;HLD15;PARS;PIG32;proliferation-inducing gene 32 protein;proliferation-inducing protein 32;proline-tRNA ligase;prolyl-tRNA synthetase;QARS;QPRS
- Weitere Details:
- Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined.
- Versandbedingungen:
- Blue Ice