A15236
Dopamine Transporter/SLC6A3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15236
- Zusätzliche Namen:
- DAT|DAT1|Dopamine Transporter/SLC6A3|PKDYS|PKDYS1
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 72kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLV
- Uniprot:
- Q01959
- Synonyme:
- DA transporter;DAT;DAT1;dopamine transporter 1;PKDYS;PKDYS1;sodium-dependent dopamine transporter;solute carrier family 6 (neurotransmitter transporter, dopamine), member 3;solute carrier family 6 (neurotransmitter transporter), member 3;Solute carrier family 6 member 3
- Weitere Details:
- This gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3' UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence.
- Versandbedingungen:
- Blue Ice