A15215
LIPH Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15215
- Zusätzliche Namen:
- AH|ARWH2|HYPT7|LAH2|LIPH|LPDLR|mPA-PLA1|PLA1B
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 54kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KLRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRYKLRILRMKLRSLAHPERPQLCRYDLVLMENVETVFQPILCPELQ
- Uniprot:
- Q8WWY8
- Synonyme:
- AH;ARWH2;HYPT7;LAH2;lipase member H;lipase, member H;LPD lipase-related protein;LPDLR;membrane-associated phosphatidic acid-selective phospholipase A1-alpha;membrane-bound phosphatidic acid-selective phospholipase A1;mPA-PLA1;mPA-PLA1 alpha;phospholipase A(1);phospholipase A1 member B;PLA1B
- Weitere Details:
- This gene encodes a membrane-bound member of the mammalian triglyceride lipase family. It catalyzes the production of 2-acyl lysophosphatidic acid (LPA), which is a lipid mediator with diverse biological properties that include platelet aggregation, smooth muscle contraction, and stimulation of cell proliferation and motility.
- Versandbedingungen:
- Blue Ice