SLC17A6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15177
Zusätzliche Namen:: DNPI|SLC17A6|VGLUT2
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 64 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
Uniprot:: Q9P2U8
Synonyme:: differentiation-associated BNPI;differentiation-associated Na-dependent inorganic phosphate cotransporter;differentiation-associated Na(+)-dependent inorganic phosphate cotransporter;DNPI;solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6;solute carrier family 17 (vesicular glutamate transporter), member 6;Solute carrier family 17 member 6;vesicular glutamate transporter 2;VGLUT2
Weitere Details:: Predicted to enable L-glutamate transmembrane transporter activity and neurotransmitter transmembrane transporter activity. Involved in neurotransmitter loading into synaptic vesicle. Predicted to be located in synaptic vesicle. Predicted to be active in excitatory synapse. Predicted to be integral component of synaptic vesicle membrane.