A15165
RNF125 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15165
- Zusätzliche Namen:
- RNF125|TNORS|TRAC-1|TRAC1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 26kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFY
- Uniprot:
- Q96EQ8
- Synonyme:
- E3 ubiquitin-protein ligase RNF125;RING finger protein 125;ring finger protein 125, E3 ubiquitin protein ligase;T-cell RING activation protein 1;T-cell ring protein identified in activation screen;TNORS;TRAC-1;TRAC1
- Weitere Details:
- This gene encodes a novel E3 ubiquitin ligase that contains a RING finger domain in the N-terminus and three zinc-binding and one ubiquitin-interacting motif in the C-terminus. As a result of myristoylation, this protein associates with membranes and is primarily localized to intracellular membrane systems. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.
- Versandbedingungen:
- Blue Ice

