HEY2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15143
Zusätzliche Namen:: bHLHb32|CHF1|GRIDLOCK|GRL|HERP1|HESR2|HEY2|HRT2
Anwendung:: ELISA, WB
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHL
Uniprot:: Q9UBP5
Synonyme:: bHLHb32;cardiovascular basic helix-loop-helix factor 1;cardiovascular helix-loop-helix factor 1;CHF1;class B basic helix-loop-helix protein 32;GRIDLOCK;GRL;hairy and enhancer of split-related protein 2;hairy-related transcription factor 2;hairy/enhancer-of-split related with YRPW motif 2;hairy/enhancer-of-split related with YRPW motif protein 2;hCHF1;HERP1;HES-related repressor protein 1;HES-related repressor protein 2;HESR-2;HESR2;hHRT2;HRT-2;HRT2;protein gridlock homolog
Weitere Details:: This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repress transcription. Expression of this gene is induced by the Notch signal transduction pathway. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternatively spliced transcript variants have been found, but their biological validity has not been determined.

Versandbedingungen:: Blue Ice