SLC22A7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15137
Zusätzliche Namen:: hOAT11|NLT|OAT2|SLC22A7
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQKG
Uniprot:: Q9Y694
Synonyme:: hOAT11;hOAT2;liver-specific transporter;NLT;novel liver transporter;OAT2;organic anion transporter 11;organic anion transporter 2;solute carrier family 22 (organic anion transporter), member 7;solute carrier family 22 member 7
Weitere Details:: The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.