RRAGA Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15134
Zusätzliche Namen:: FIP-1|FIP1|RAGA|RRAGA
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 33kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR
Uniprot:: Q7L523
Synonyme:: adenovirus E3 14.7 kDa-interacting protein 1;adenovirus E3-14.7K interacting protein 1;FIP-1;FIP1;rag A;RAGA;ras-related GTP-binding protein A
Weitere Details:: Enables several functions, including GTP binding activity; protein dimerization activity; and ubiquitin protein ligase binding activity. Involved in several processes, including cellular response to amino acid starvation; negative regulation of autophagy; and positive regulation of TORC1 signaling. Located in lysosome and nucleus. Colocalizes with GATOR1 complex.