Sec23B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15131
Zusätzliche Namen:: CDA-II|CDAII|CDAN2|CWS7|HEMPAS|hSec23B|Sec23B
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 86kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SLQMSLSLLPPDALVGLITFGRMVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQ
Uniprot:: Q15437
Synonyme:: CDA-II;CDAII;CDAN2;CWS7;HEMPAS;hSec23B;protein transport protein Sec23B;SEC23 homolog B, coat complex II component;SEC23-like protein B;SEC23-related protein B;transport protein SEC23B
Weitere Details:: The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function of this gene product has been implicated in cargo selection and concentration. Multiple alternatively spliced transcript variants have been identified in this gene.