A15129
RTN3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15129
- Zusätzliche Namen:
- ASYIP|HAP|NSPL2|NSPLII|RTN3|RTN3-A1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 26kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- YKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE
- Uniprot:
- O95197
- Synonyme:
- ASY interacting protein;ASYIP;HAP;homolog of ASY protein;neuroendocrine-specific protein-like 2;neuroendocrine-specific protein-like II;NSP-like protein 2;NSP-like protein II;NSPL2;NSPLII;reticulon-3;RTN3-A1
- Weitere Details:
- This gene belongs to the reticulon family of highly conserved genes that are preferentially expressed in neuroendocrine tissues. This family of proteins interact with, and modulate the activity of beta-amyloid converting enzyme 1 (BACE1), and the production of amyloid-beta. An increase in the expression of any reticulon protein substantially reduces the production of amyloid-beta, suggesting that reticulon proteins are negative modulators of BACE1 in cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, and pseudogenes of this gene are located on chromosomes 4 and 12.
- Versandbedingungen:
- Blue Ice

