OXSR1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15126
Zusätzliche Namen:: OSR1|OXSR1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSV
Uniprot:: O95747
Synonyme:: OSR1;oxidative stress responsive 1;oxidative stress-responsive 1 protein;serine/threonine-protein kinase OSR1
Weitere Details:: The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton.