PDCD7 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A1510
Zusätzliche Namen:: 59K|ES18|HES18|PDCD7
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRPFPG
Uniprot:: Q8N8D1
Synonyme:: 59K;apoptosis-related protein ES18;ES18;HES18;programmed cell death protein 7;U11/U12 snRNP 59K
Weitere Details:: This gene encodes a 59 kDa protein that is associated with the U11 small nuclear ribonucleoprotein (snRNP), which is a component of the minor U12-type spliceosome responsible for catalyzing pre-mRNA splicing of U12-type introns.