SCNN1G Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15097
Zusätzliche Namen:: BESC3|ENaCg|ENaCgamma|LDLS2|PHA1|PHA1B3|SCNEG|SCNN1G
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 74kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMS
Uniprot:: P51170
Synonyme:: amiloride-sensitive epithelial sodium channel gamma subunit;amiloride-sensitive sodium channel gamma-subunit;amiloride-sensitive sodium channel subunit gamma;BESC3;ENaC gamma subunit;ENaCg;ENaCgamma;epithelial Na(+) channel subunit gamma;gamma-ENaC;gamma-NaCH;LDLS2;nonvoltage-gated sodium channel 1 subunit gamma;PHA1;SCNEG;sodium channe epithelial 1 gamma subunit;sodium channel epithelial 1 gamma subunit;sodium channel, non-voltage-gated 1, gamma subunit;sodium channel, nonvoltage-gated 1, gamma
Weitere Details:: Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the gamma subunit, and mutations in this gene have been associated with Liddle syndrome.

Versandbedingungen:: Blue Ice