ADIPOR1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1509
Zusätzliche Namen:: ACDCR1|ADIPOR1|CGI-45|CGI45|PAQR1|TESBP1A
Anwendung:: ELISA, WB
Molekulargewicht:: 43kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQE
Uniprot:: Q96A54
Synonyme:: ACDCR1;adiponectin receptor protein 1;CGI-45;CGI45;PAQR1;progestin and adipoQ receptor family member 1;progestin and adipoQ receptor family member I;TESBP1A
Weitere Details:: This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene.