A15068
IGFBP4 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15068
- Zusätzliche Namen:
- BP-4|HT29-IGFBP|IBP4|IGFBP-4|IGFBP4
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
- Uniprot:
- P22692
- Synonyme:
- BP-4;HT29-IGFBP;IBP-4;IBP4;IGF-binding protein 4;IGFBP-4;insulin-like growth factor-binding protein 4
- Weitere Details:
- This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
- Versandbedingungen:
- Blue Ice