TET1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1506
Zusätzliche Namen:: bA119F7.1|CXXC6|LCX|TET1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 250 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TLGSNTETVQPEVKSETEPHFILKSSDNTKTYSLMPSAPHPVKEASPGFSWSPKTASATPAPLKNDATASCGFSERSSTPHCTMPSGRLSGANAAAADGPG
Uniprot:: Q8NFU7
Synonyme:: bA119F7.1;CXXC finger 6;CXXC zinc finger 6;CXXC-type zinc finger protein 6;CXXC6;LCX;leukemia-associated protein with a CXXC domain;methylcytosine dioxygenase TET1;ten-eleven translocation 1 gene protein;ten-eleven translocation-1;tet oncogene 1;TET1 splice variant VP_DE4;TET1 splice variant VP_DE456
Weitere Details:: DNA methylation is an epigenetic mechanism that is important for controlling gene expression. The protein encoded by this gene is a demethylase that belongs to the TET (ten-eleven translocation) family. Members of the TET protein family play a role in the DNA methylation process and gene activation.