FUT3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15058
Zusätzliche Namen:: CD174|FT3B|FucT-III|FUT3|LE|Les
Anwendung:: ELISA, WB
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVY
Uniprot:: P21217
Synonyme:: 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3;alpha-(1,3/1,4)-fucosyltransferase;alpha-3-fucosyltransferase FUT3;blood group Lewis alpha-4-fucosyltransferase;CD174;FT3B;Fucosyltransferase 3;fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group);fucosyltransferase III;FucT-III;galactoside 3(4)-L-fucosyltransferase;LE;Les;Lewis FT;truncated fucosyltransferase 3
Weitere Details:: The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Mutations in this gene are responsible for the majority of Lewis antigen-negative phenotypes. Differences in the expression of this gene are associated with host susceptibility to viral infection.

Versandbedingungen:: Blue Ice