LTB4R Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15042
Zusätzliche Namen:: BLT1|BLTR|CMKRL1|GPR16|LTB4R|LTB4R1|LTBR1|P2RY7|P2Y7
Anwendung:: ELISA, WB
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Uniprot:: Q15722
Synonyme:: BLT1;BLTR;chemoattractant receptor-like 1;chemokine receptor-like 1;CMKRL1;G protein-coupled receptor 16;G-protein coupled receptor 16;GPR16;leukotriene B4 receptor 1;LTB4-R 1;LTB4-R1;LTB4R1;LTBR1;P2RY7;P2Y purinoceptor 7;P2Y7;purinergic receptor P2Y, G-protein coupled, 7
Weitere Details:: Predicted to enable G protein-coupled peptide receptor activity and leukotriene B4 receptor activity. Predicted to be involved in inflammatory response and neuropeptide signaling pathway. Predicted to act upstream of or within signal transduction. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane.