A15041
CLCA1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15041
- Zusätzliche Namen:
- CACC|CaCC-1|CACC1|CLCA1|CLCRG1|GOB5|hCaCC-1|hCLCA1
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 85kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLFEATGKRFYFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQ
- Uniprot:
- A8K7I4
- Synonyme:
- CACC;CaCC-1;CACC1;calcium-activated chloride channel family member 1;calcium-activated chloride channel protein 1;calcium-activated chloride channel regulator 1;calcium-dependent chloride channel-1;chloride channel regulator 1;chloride channel, calcium activated, family member 1;CLCA family member 1, chloride channel regulator;CLCRG1;GOB5;hCaCC-1;hCLCA1
- Weitere Details:
- This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine.
- Versandbedingungen:
- Blue Ice







