AARS Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15017
Zusätzliche Namen:: AARS|CMT2N|DEE29|EIEE29|HDLS2|TTD8
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 107 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEM
Uniprot:: P49588
Synonyme:: AARS;alanine tRNA ligase 1, cytoplasmic;alanine--tRNA ligase, cytoplasmic;Alanyl-tRNA synthetase;alanyl-tRNA synthetase, cytoplasmic;alaRS;CMT2N;DEE29;EIEE29;renal carcinoma antigen NY-REN-42
Weitere Details:: The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure.