A14989
HBG1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14989
- Zusätzliche Namen:
- HBG-T2|HBG1|HBGA|HBGR|HSGGL1|PRO2979
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 12kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVD
- Uniprot:
- P69891
- Synonyme:
- A-gamma globin;gamma A hemoglobin;gamma globin;gamma-1-globin;hb F Agamma;HBG-T2;HBGA;HBGR;hemoglobin gamma-1 chain;hemoglobin gamma-a chain;hemoglobin subunit gamma-1;hemoglobin, gamma A;hemoglobin, gamma, regulator of;HSGGL1;PRO2979
- Weitere Details:
- The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.
- Versandbedingungen:
- Blue Ice

