UNC5B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14978
Zusätzliche Namen:: p53RDL1|UNC5B|UNC5H2
Anwendung:: ELISA, WB
Molekulargewicht:: 104kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDPNSHLLEASGDAALY
Uniprot:: Q8IZJ1
Synonyme:: netrin receptor UNC5B;p53-regulated receptor for death and life protein 1;p53RDL1;protein unc-5 homolog 2;protein unc-5 homolog B;transmembrane receptor Unc5H2;unc-5 homolog 2;unc-5 homolog B;UNC5H2
Weitere Details:: This gene encodes a member of the netrin family of receptors. This particular protein mediates the repulsive effect of netrin-1 and is a vascular netrin receptor. This encoded protein is also in a group of proteins called dependence receptors (DpRs) which are involved in pro- and anti-apoptotic processes. Many DpRs are involved in embryogenesis and in cancer progression. Two alternatively spliced transcript variants have been described for this gene.