KCNU1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14967
Zusätzliche Namen:: KCa5|KCa5.1|Kcnma3|KCNMC1|KCNU1|Slo3|SPGF79
Anwendung:: ELISA, WB
Molekulargewicht:: 130kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LELLQMLVTGGVSSQLEQHLDKDKVYGVADSCTSLLSGRNRCKLGLLSLHETILSDVNPRNTFGQLFCGSLDLFGILCVGLYRIIDEEELNPENKRFVITRPANEFKLLPSDLVFCAIPFSTACYKRNEEFSLQKSYEIVNKASQTTETHSDTNCPPTIDSVTETLYSPVYSYQPRTNSLSFPKQIAWNQSRTNSIISSQIPLGDNAKENERKTSDEVYDEDPFAYSEPL
Uniprot:: A8MYU2
Synonyme:: Calcium-activated potassium channel subunit alpha-3;Calcium-activated potassium channel, subfamily M subunit alpha-3;KCa5;KCa5.1;Kcnma3;KCNMC1;potassium channel subfamily U member 1;potassium channel, subfamily U, member 1;Slo3;Slowpoke homolog 3
Weitere Details:: This gene encodes a member of the potassium channel family of proteins. The encoded voltage-gated ion channel allows the outward flow of potassium ions during plasma membrane hyperpolarization in sperm. Opening of this channel may be regulated by calcium ion levels. Homozygous knockout mice that lack the related mouse gene exhibit male sterility. Alternative splicing results in multiple transcript variants.