SLCO6A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14963
Zusätzliche Namen:: CT48|GST|OATP-I|OATP6A1|OATPY|SLCO6A1
Anwendung:: ELISA, WB
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VQFAGINEDYDGTGKLGNLTAPCNEKCRCSSSIYSSICGRDDIEYFSPCFAGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL
Uniprot:: Q86UG4
Synonyme:: cancer/testis antigen 48;CT48;gonad-specific transporter;GST;OATP-I;OATP6A1;OATPY;Organic anion-transporting polypeptide 6A1;organic anion-transporting polypeptide I;solute carrier family 21 member 19;solute carrier organic anion transporter family member 6A1;testicular tissue protein Li 174;testis-specific organic anion transporter
Weitere Details:: Predicted to enable sodium-independent organic anion transmembrane transporter activity. Predicted to be involved in sodium-independent organic anion transport. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane.