OCIAD2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14962
Zusätzliche Namen:: OCIAD2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 17kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MASASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLVYQGYLAANSRFGSLPKVARTASLPVRNAK
Uniprot:: Q56VL3
Synonyme:: OCIA domain-containing protein 2;ovarian cancer immunoreactive antigen domain containing 2;ovarian carcinoma immunoreactive antigen-like protein
Weitere Details:: Predicted to be involved in endocytosis; hematopoietic stem cell homeostasis; and positive regulation of receptor signaling pathway via JAK-STAT. Predicted to act upstream of or within response to bacterium. Predicted to be located in Golgi apparatus; endosome; and lysosome.