CBLL1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14932
Zusätzliche Namen:: CBLL1|HAKAI|RNF188
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGEKDDTPVHFCDKCGLPIKIYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRASLENVHPPIAPPPTEIPERFIMPPDKHHMSHIPPKQHIMM
Uniprot:: Q75N03
Synonyme:: c-Cbl-like protein 1;Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1;casitas B-lineage lymphoma-transforming sequence-like protein 1;Cbl proto-oncogene like 1, E3 ubiquitin protein ligase;Cbl proto-oncogene, E3 ubiquitin protein ligase-like 1;E-cadherin binding protein E7;E3 ubiquitin-protein ligase Hakai;HAKAI;RING finger protein 188;RING-type E3 ubiquitin transferase Hakai;RNF188
Weitere Details:: This gene encodes an E3 ubiquitin-ligase for the E-cadherin complex and mediates its ubiquitination, endocytosis, and degradation in the lysosomes. The encoded protein contains a RING-finger domain and is also thought to have a role in control of cell proliferation. A related pseudogene has been identified on chromosome X. Alternative splicing results in a non-coding transcript variant.

Versandbedingungen:: Blue Ice