A14932
CBLL1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14932
- Zusätzliche Namen:
- CBLL1|HAKAI|RNF188
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGEKDDTPVHFCDKCGLPIKIYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRASLENVHPPIAPPPTEIPERFIMPPDKHHMSHIPPKQHIMM
- Uniprot:
- Q75N03
- Synonyme:
- c-Cbl-like protein 1;Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1;casitas B-lineage lymphoma-transforming sequence-like protein 1;Cbl proto-oncogene like 1, E3 ubiquitin protein ligase;Cbl proto-oncogene, E3 ubiquitin protein ligase-like 1;E-cadherin binding protein E7;E3 ubiquitin-protein ligase Hakai;HAKAI;RING finger protein 188;RING-type E3 ubiquitin transferase Hakai;RNF188
- Weitere Details:
- This gene encodes an E3 ubiquitin-ligase for the E-cadherin complex and mediates its ubiquitination, endocytosis, and degradation in the lysosomes. The encoded protein contains a RING-finger domain and is also thought to have a role in control of cell proliferation. A related pseudogene has been identified on chromosome X. Alternative splicing results in a non-coding transcript variant.
- Versandbedingungen:
- Blue Ice

