FNDC4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14925
Zusätzliche Namen:: FNDC4|FRCP1
Anwendung:: ELISA, WB
Molekulargewicht:: 25kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQT
Uniprot:: Q9H6D8
Synonyme:: fibronectin type III domain-containing protein 4;fibronectin type III repeat-containing protein 1;FRCP1
Weitere Details:: Involved in response to transforming growth factor beta. Predicted to be located in endoplasmic reticulum and extracellular space. Predicted to be active in extracellular region and plasma membrane.