A14924
RMND5A Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14924
- Zusätzliche Namen:
- CTLH|GID2|GID2A|p44CTLH|RMD5|RMND5A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 44kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ISLLMGGTTNQREALQYAKNFQPFALNHQKDIQVLMGSLVYLRQGIENSPYVHLLDANQWADICDIFTRDA
- Uniprot:
- Q9H871
- Synonyme:
- 44-kD protein coding for CTLH motif;C-terminal to LisH motif, 44 kDa;CTLH;E3 ubiquitin-protein transferase RMND5A;GID complex subunit 2 homolog A;GID2;GID2A;p44CTLH;protein RMD5 homolog A;RMD5
- Weitere Details:
- Predicted to enable metal ion binding activity and ubiquitin protein ligase activity. Predicted to contribute to ubiquitin-protein transferase activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process and protein polyubiquitination. Located in cytoplasm and nucleoplasm. Part of ubiquitin ligase complex.
- Versandbedingungen:
- Blue Ice