A14915
ZNF248 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14915
- Zusätzliche Namen:
- bA162G10.3|ZNF248
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 67kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MNKSQEQVSFKDVCVDFTQEEWYLLDPAQKILYRDVILENYSNLVSVGYCITKPEVIFKIEQGEEPWILEKGFPSQCHPERKWKVDDVLESSQENEDDHFWELLFHNNKT
- Uniprot:
- Q8NDW4
- Synonyme:
- bA162G10.3;bA162G10.3 (zinc finger protein);KRAB protein domain;Kruppel-type zinc finger protein;zinc finger protein 248
- Weitere Details:
- Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.
- Versandbedingungen:
- Blue Ice