A1491
POT1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1491
- Zusätzliche Namen:
- CMM10|GLM9|HPOT1|POT1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 75kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI
- Uniprot:
- Q9NUX5
- Synonyme:
- CMM10;GLM9;HPOT1;POT1-like telomere end-binding protein;protection of telomeres 1 homolog;protection of telomeres protein 1
- Weitere Details:
- This gene is a member of the telombin family and encodes a nuclear protein involved in telomere maintenance. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere length and protecting chromosome ends from illegitimate recombination, catastrophic chromosome instability, and abnormal chromosome segregation. Increased transcriptional expression of this gene is associated with stomach carcinogenesis and its progression. Alternatively spliced transcript variants have been described.
- Versandbedingungen:
- Blue Ice