A14906
BATF3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14906
- Zusätzliche Namen:
- BATF3|JDP1|JUNDM1|SNFT
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
- Uniprot:
- Q9NR55
- Synonyme:
- 21 kDa small nuclear factor isolated from T-cells;21-kD small nuclear factor isolated from T cells;B-ATF-3;basic leucine zipper transcription factor, ATF-like 3;basic leucine zipper transcriptional factor ATF-like 3;JDP1;Jun dimerization protein 1;Jun dimerization protein p21SNFT;JUNDM1;SNFT
- Weitere Details:
- This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.
- Versandbedingungen:
- Blue Ice