GPR173 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14897
Zusätzliche Namen:: GPR173|SREB3
Anwendung:: ELISA, WB
Molekulargewicht:: 53kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FDVGTYKFIREEDQCIFEHRYFKANDTLGFMLMLAVLMAATHAVYGKLLLFEYRHRKMKPVQMVPAISQNW
Uniprot:: Q9NS66
Synonyme:: probable G-protein coupled receptor 173;SREB3;super conserved receptor expressed in brain 3
Weitere Details:: This gene encodes a member of the G-protein coupled receptor 1 family. This protein contains 7 transmembrane domains and conserved cysteine residues.