PPIL1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14892
Zusätzliche Namen:: CGI-124|CYPL1|hCyPX|PCH14|PPIase|PPIL1
Anwendung:: ELISA, WB
Molekulargewicht:: 18kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Uniprot:: Q9Y3C6
Synonyme:: CGI-124;cyclophilin like 1;cyclophilin-related gene 1;CYPL1;hCyPX;PCH14;peptidyl-prolyl cis-trans isomerase;peptidyl-prolyl cis-trans isomerase-like 1;peptidylprolyl isomerase (cyclophilin)-like 1;PPIase;rotamase PPIL1
Weitere Details:: This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.