Bif-1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14887
Zusätzliche Namen:: Bif-1|CGI-61|dJ612B15.2|PPP1R70
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIGSSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITYLELLN
Uniprot:: Q9Y371
Synonyme:: Bax-interacting factor 1;Bif-1;CGI-61;dJ612B15.2;endophilin-B1;PPP1R70;protein phosphatase 1, regulatory subunit 70;SH3 domain-containing GRB2-like protein B1;SH3-containing protein SH3GLB1;SH3-domain GRB2 like endophilin B1;testicular tissue protein Li 172
Weitere Details:: This gene encodes a SRC homology 3 domain-containing protein. The encoded protein interacts with the proapoptotic member of the Bcl-2 family, Bcl-2-associated X protein (Bax) and may be involved in regulating apoptotic signaling pathways. This protein may also be involved in maintaining mitochondrial morphology. Alternate splicing results in multiple transcript variants.