A14877
HTRA2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14877
- Zusätzliche Namen:
- HTRA2|MGCA8|OMI|PARK13|PRSS25
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 36kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
- Uniprot:
- O43464
- Synonyme:
- epididymis secretory sperm binding protein;high temperature requirement protein A2;HtrA-like serine protease;MGCA8;OMI;Omi stress-regulated endoprotease;PARK13;protease, serine, 25;PRSS25;serine protease 25;serine protease HTRA2, mitochondrial;serine proteinase OMI
- Weitere Details:
- This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice



