[KO Validated] Peroxiredoxin 4 (PRDX4) Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A1486
Zusätzliche Namen:: 4)|AOE37-2|AOE372|HEL-S-97n|PRX-4
Anwendung:: ELISA, WB
Molekulargewicht:: 28kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Uniprot:: Q13162
Synonyme:: antioxidant enzyme AOE372;AOE37-2;AOE372;epididymis secretory sperm binding protein Li 97n;HEL-S-97n;peroxiredoxin IV;peroxiredoxin-4;PRX-4;prx-IV;thioredoxin peroxidase (antioxidant enzyme);thioredoxin peroxidase AO372;thioredoxin-dependent peroxide reductase A0372;thioredoxin-dependent peroxiredoxin 4
Weitere Details:: The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.

Versandbedingungen:: Blue Ice