A14847
ZNF273 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14847
- Zusätzliche Namen:
- HZF9|ZNF273
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 65kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ECGKSCCILSQLTQHKKTATRVNFYKCKTCGKAFNQFSNLTKHKIIHPEVN
- Uniprot:
- Q14593
- Synonyme:
- HZF9;zinc finger protein 273;zinc finger protein 9;zinc finger protein HZF9
- Weitere Details:
- This gene is a member of the krueppel C2H2-type zinc-finger protein family and encodes a protein with 13 C2H2-type zinc fingers and a KRAB domain. This nuclear protein is involved in transcriptional regulation. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice