A14841
DCTN2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14841
- Zusätzliche Namen:
- DCTN2|DCTN50|DYNAMITIN|HEL-S-77|RBP50
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 44kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERM
- Uniprot:
- Q13561
- Synonyme:
- 50 kDa dynein-associated polypeptide;DCTN50;dynactin 2 (p50);dynactin complex 50 kDa subunit;dynactin subunit 2;DYNAMITIN;epididymis secretory protein Li 77;epididymis secretory sperm binding protein;HEL-S-77;p50 dynamitin;RBP50
- Weitere Details:
- This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice