A14838
EMC8 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14838
- Zusätzliche Namen:
- C16orf2|C16orf4|COX4NB|EMC8|FAM158B|NOC4
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 24kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
- Uniprot:
- O43402
- Synonyme:
- C16orf2;C16orf4;COX4 neighbor;COX4NB;ER membrane protein complex subunit 8;FAM158B;family with sequence similarity 158, member B;neighbor of COX4;NOC4;Protein FAM158B
- Weitere Details:
- Contributes to membrane insertase activity. Involved in protein insertion into ER membrane by stop-transfer membrane-anchor sequence and tail-anchored membrane protein insertion into ER membrane. Located in cytosol. Part of EMC complex.
- Versandbedingungen:
- Blue Ice