A14826
BAG3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A14826
- Zusätzliche Namen:
- BAG-3|BAG3|BIS|CAIR-1|MFM6
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHPGVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
- Uniprot:
- O95817
- Synonyme:
- BAG family molecular chaperone regulator 3;BAG-3;Bcl-2-associated athanogene 3;bcl-2-binding protein Bis;Bcl-2-binding protein BIS transcript 2;BCL2 associated athanogene 3;BCL2-binding athanogene 3;BIS;CAIR-1;docking protein CAIR-1;MFM6
- Weitere Details:
- BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner.
- Versandbedingungen:
- Blue Ice