SLC4A8 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14825
Zusätzliche Namen:: NBC3|NDCBE|SLC4A8
Anwendung:: ELISA, WB
Molekulargewicht:: 123kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEAL
Uniprot:: Q2Y0W8
Synonyme:: electroneutral Na(+)-driven Cl-HCO3 exchanger;electroneutral sodium bicarbonate exchanger 1;k-NBC3;NBC3;NDCBE;Solute carrier family 4 member 8;solute carrier family 4, sodium bicarbonate cotransporter, member 8
Weitere Details:: The protein encoded by this gene is a membrane protein that functions to transport sodium and bicarbonate ions across the cell membrane. The encoded protein is important for pH regulation in neurons. The activity of this protein can be inhibited by 4,4'-Di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS). Several transcript variants encoding different isoforms have been found for this gene.