UNC5C Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14809
Zusätzliche Namen:: UNC5C|UNC5H3
Anwendung:: ELISA, WB
Molekulargewicht:: 103kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
Uniprot:: O95185
Synonyme:: netrin receptor UNC5C;protein unc-5 homolog 3;protein unc-5 homolog C;unc-5 homolog 3;unc-5 homolog C;unc5 (C.elegans homolog) c;UNC5H3
Weitere Details:: This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.