FSHR Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1480
Zusätzliche Namen:: FSHR|FSHR1|FSHRO|LGR1|ODG1
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 72kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTSGSTYILVPLSHLAQN
Uniprot:: P23945
Synonyme:: follicle-stimulating hormone receptor;follitropin receptor;FSH receptor;FSHR1;FSHRO;LGR1;ODG1
Weitere Details:: The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Mutations in this gene cause ovarian dysgenesis type 1, and also ovarian hyperstimulation syndrome. Alternative splicing results in multiple transcript variants.