[KO Validated] MAP2K4 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A14781
Zusätzliche Namen:: JNKK|JNKK1|K4|MAPKK4|MEK4|MKK4|PRKMK4|SAPKK-1|SAPKK1|SEK1|SERK1|SKK1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 44kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
Uniprot:: P45985
Synonyme:: c-Jun N-terminal kinase kinase 1;dual specificity mitogen-activated protein kinase kinase 4;JNK-activated kinase 1;JNK-activating kinase 1;JNKK;JNKK1;MAP kinase kinase 4;MAPK/ERK kinase 4;MAPKK 4;MAPKK4;MEK 4;MEK4;MKK4;PRKMK4;SAPK/ERK kinase 1;SAPKK-1;SAPKK1;SEK1;SERK1;SKK1;stress-activated protein kinase kinase 1
Weitere Details:: This gene encodes a member of the mitogen-activated protein kinase (MAPK) family. Members of this family act as an integration point for multiple biochemical signals and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. They form a three-tiered signaling module composed of MAPKKKs, MAPKKs, and MAPKs. This protein is phosphorylated at serine and threonine residues by MAPKKKs and subsequently phosphorylates downstream MAPK targets at threonine and tyrosine residues. A similar protein in mouse has been reported to play a role in liver organogenesis. A pseudogene of this gene is located on the long arm of chromosome X. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice