RBBP6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14776
Zusätzliche Namen:: MY038|P2P-R|PACT|RBBP6|RBQ-1|SNAMA
Anwendung:: ELISA, WB
Molekulargewicht:: 210kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SKVKQEKVKGKVRRKVTGTEGSSSTLVDYTSTSSTGGSPVRKSEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTK
Uniprot:: Q7Z6E9
Synonyme:: E3 ubiquitin-protein ligase RBBP6;MY038;P2P-R;p53-associated cellular protein of testis;PACT;proliferation potential-related protein;protein P2P-R;RB-binding Q-protein 1;RBQ-1;retinoblastoma binding protein 6;Retinoblastoma-binding protein 6;retinoblastoma-binding Q protein 1;RING-type E3 ubiquitin transferase RBBP6;SNAMA
Weitere Details:: The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene.